PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK38471.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 667aa    MW: 73213.2 Da    PI: 6.5781
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK38471.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.23.7e-13184243160
                 XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                 e ++k+  r+++NRe+A+ sR+RKk+++eeL+ kvk++ +   +L  +++    e  +l+
  KFK38471.1 184 EDDDKKKVRLIRNRESAQLSRLRKKQYVEELQGKVKSMNSTIAELNGKISYVMAENVALR 243
                 5789*********************************99998888877776666655555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.5E-14181246No hitNo description
SMARTSM003389.2E-16184248IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.68186249IPR004827Basic-leucine zipper domain
PfamPF001702.5E-10186245IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-12188246No hitNo description
CDDcd147046.52E-17189239No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006990Biological Processpositive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response
GO:0009408Biological Processresponse to heat
GO:0005635Cellular Componentnuclear envelope
GO:0005654Cellular Componentnucleoplasm
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0048471Cellular Componentperinuclear region of cytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    Send to blast
MTESTSILVH PPEISNLNPN LYSDSDKISI PPLDFPFLSD PNSMEQSISD LDLDFLFDDE  60
NGDFADIDFT LDDDSDDFFN FNLDADPTAA MGDQIPEVIG NHPNLDSSEA VRDGSEERSD  120
SVHSQVSSQG SKTYISGVND ALSSPDSSNP QKSSVTKRKK ESGGDYRSFK YQKSDEKSVA  180
TIEEDDDKKK VRLIRNRESA QLSRLRKKQY VEELQGKVKS MNSTIAELNG KISYVMAENV  240
ALRQQMAVAS GAPPMNPYMA GPPLPYQWMP YPHYPVRGYG SQTPLVPIPK LNPKPVSSRP  300
KKTESKRSEG KSKVKKVASV SFIGILFFMF LFGMLVPFMN VNYGGESGRF SGLSSYEGRR  360
YYDEHKGRVL MVGDGSDVRR ESGVSEGNVH SSRRNHGERD SCGGVDYNGH PKVEGRPSPL  420
SNASEPLFAS LYVPRNDGLV KIDGNLIIHS VLASEKAMAS GKKSIPETVK SKEPHSTVPG  480
AVSSALAVPE VRGNGELLLH SPEGKRLHQW FHEGGSGTLM DYSMCTEVFQ FDVAPGAIVP  540
SSVSNITRER LQNVTTHDKR MKNRRILGGL PVSLVPSEPN ITDTQPSKDA QNKSFSGNAN  600
KKPTSSSSMV VSVLLDPREI VDSETDRVIP PNPKSLSRIF VVVLLDSVKY VTYSCVLPRT  660
GLHLVAT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00345DAPTransfer from AT3G10800Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882698.10.0bZIP transcription factor family protein
SwissprotQ9SG860.0BZP28_ARATH; bZIP transcription factor 28
TrEMBLA0A087H8L90.0A0A087H8L9_ARAAL; Uncharacterized protein
STRINGfgenesh2_kg.3__1116__AT3G10800.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM143971822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10800.10.0bZIP family protein